TAF1 48 (TAF1A) (NM_005681) Human Mass Spec Standard

SKU
PH312971
TAF1A MS Standard C13 and N15-labeled recombinant protein (NP_005672)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212971]
Predicted MW 52.5 kDa
Protein Sequence
Protein Sequence
>RC212971 representing NM_005681
Red=Cloning site Green=Tags(s)

MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSFIQEALLKHQW
QQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQH
ALYLLHHGMLKDAKRNLSEAETWRHGENTSSREILINLIQAYKGLLQYYTWSEKKMELSKLDKDDYAYNA
VAQDVFNHSWKTSANISALIKIPGVWDPFVKSYVEMLEFYGDRDGAQEVLTNYAYDEKFPSNPNAHIYLY
NFLKRQKAPRSKLISVLKILYQIVPSHKLMLEFHTLLRKSEKEEHRKLGLEVLFGVLDFAGCTKNITAWK
YLAKYLKNILMGNHLAWVQEEWNSRKNWWPGFHFSYFWAKSDWKEDTALACEKAFVAGLLLGKGCRYFRY
ILKQDHQILGKKIKRMKRSVKKYSIVNPRL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005672
RefSeq Size 1893
RefSeq ORF 1350
Synonyms MGC:17061; RAFI48; SL1; TAFI48
Locus ID 9015
UniProt ID Q15573
Cytogenetics 1q41
Summary This gene encodes a subunit of the RNA polymerase I complex, Selectivity Factor I (SLI). The encoded protein is a TATA box-binding protein-associated factor that plays a role in the assembly of the RNA polymerase I preinitiation complex. Alternate splicing results in multiple transcript variants encoding multiple isoforms.[provided by RefSeq, Jan 2011]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:TAF1 48 (TAF1A) (NM_005681) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401732 TAF1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408297 TAF1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401732 Transient overexpression lysate of TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 1 100 ug
$436.00
LY408297 Transient overexpression lysate of TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 2 100 ug
$436.00
TP312971 Recombinant protein of human TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760550 Purified recombinant protein of Human TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.