C1ORF151 (MINOS1) (NM_001032363) Human Mass Spec Standard

SKU PH312930

C1orf151 MS Standard C13 and N15-labeled recombinant protein (NP_001027535)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC212930]
• Predicted MW: 8.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC212930 protein sequence; Red=Cloning site Green=Tags(s); ; MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHG; KYVKEQEQ; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001027535
• RefSeq Size: 3726
• RefSeq ORF: 234
• Synonyms: C1orf151; Mic10; MINOS1; MIO10
• Locus ID: 440574
• UniProt ID: Q5TGZ0
• Cytogenetics: 1p36.13
• Summary: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane