SCYL1BP1 (GORAB) (NM_152281) Human Mass Spec Standard

SKU
PH312883
GORAB MS Standard C13 and N15-labeled recombinant protein (NP_689494)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212883]
Predicted MW 44.8 kDa
Protein Sequence
Protein Sequence
>RC212883 representing NM_152281
Red=Cloning site Green=Tags(s)

MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALV
EQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPFSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENS
HDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLMEEKNKRKKALLAKAIAERSKRTQAETMKL
KRIQKELQALDDMVSADIGILRNRIDQASLDYSYARKRFDRAEAEYIAAKLDIQRKTEIKEQLTEHLCTI
IQQNELRKAKKLEELMQQLDVEADEETLELEVEVERLLHEQEVESRRPVVRLERPFQPAEESVTLEFAKE
NRKCQEQAVSPKVDDQCGNSSSIPFLSPNCPNQEGNDISAALAT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689494
RefSeq Size 2186
RefSeq ORF 1182
Synonyms GO; NTKLBP1; SCYL1BP1
Locus ID 92344
UniProt ID Q5T7V8
Cytogenetics 1q24.2
Summary This gene encodes a member of the golgin family, a group of coiled-coil proteins localized to the Golgi. The encoded protein may function in the secretory pathway. The encoded protein, which also localizes to the cytoplasm, was identified by interactions with the N-terminal kinase-like protein, and thus it may function in mitosis. Mutations in this gene have been associated with geroderma osteodysplastica. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]
Write Your Own Review
You're reviewing:SCYL1BP1 (GORAB) (NM_152281) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407701 GORAB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407701 Transient overexpression lysate of golgin, RAB6-interacting (GORAB), transcript variant 1 100 ug
$436.00
TP312883 Recombinant protein of human golgin, RAB6-interacting (GORAB), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.