ALKBH3 (NM_139178) Human Mass Spec Standard

SKU
PH312873
ALKBH3 MS Standard C13 and N15-labeled recombinant protein (NP_631917)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212873]
Predicted MW 33.2 kDa
Protein Sequence
Protein Sequence
>RC212873 representing NM_139178
Red=Cloning site Green=Tags(s)

MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPR
VIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGIKEDITYQQPRLTAWYGELP
YTYSRITMEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFG
ATRTFEMRKKPPPEENGEYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_631917
RefSeq Size 1520
RefSeq ORF 841
Synonyms ABH3; DEPC-1; DEPC1; hABH3; PCA1
Locus ID 221120
UniProt ID Q96Q83
Cytogenetics 11p11.2
Summary The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:ALKBH3 (NM_139178) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403381 ALKBH3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403381 Transient overexpression lysate of alkB, alkylation repair homolog 3 (E. coli) (ALKBH3) 100 ug
$436.00
TP312873 Recombinant protein of human alkB, alkylation repair homolog 3 (E. coli) (ALKBH3), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.