OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TBX10 (NM_005995) Human Mass Spec Standard

Be the first to review this product
SKU
PH312862
TBX10 MS Standard C13 and N15-labeled recombinant protein (NP_005986)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350486 Rabbit Polyclonal Anti-TBX10 rabbit polyclonal antibody
100 ul
$205.00
LY416940 Transient overexpression lysate of T-box 10 (TBX10) (as WB positive control) 100 ug
$436.00

Other products for "TBX10 or NM_005995"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212862
Predicted MW 42.3 kDa
Protein Sequence
Protein Sequence
>RC212862 protein sequence
Red=Cloning site Green=Tags(s)

MAAFLSAGLGILAPSETYPLPTTSSGWEPRLGSPFPSGPCTSSTGAQAVAEPTGQGPKNPRVSRVTVQLE
MKPLWEEFNQLGTEMIVTKAGRRMFPPFQVKILGMDSLADYALLMDFIPLDDKRYRYAFHSSAWLVAGKA
DPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVFVDPRKDSERY
AQENFKSFIFTETQFTAVTAYQNHRITQLKIASNPFAKGFRESDLDSWPVAPRPLLSVPARSHSSLSPCV
LKGATDREKDPNKASASTSKTPAWLHHQLLPPPEVLLAPATYRPVTYQSLYSGAPSHLGIPRTRPAPYPL
PNIRADRDQGGLPLPAGLGLLSPTVVCLGPGQDSQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005986
RefSeq Size 1557
RefSeq ORF 1155
Synonyms TBX7; TBX13
Locus ID 347853
UniProt ID O75333
Cytogenetics 11q13.2
Summary This gene encodes a member of the T-box family of transcription factors. These transcription factors share a DNA-binding domain called the T-box, and play a role in several developmental processes including early embryonic cell fate and organogenesis. The encoded protein is a member of the T-box 1 subfamily. Mutations in this gene are thought to be a cause of isolated cleft lip with or without cleft palate. provided by RefSeq, Nov 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TBX10" proteins (3)
SKU Description Size Price
LC416940 Lyophilized TBX10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416940 Transient overexpression lysate of T-box 10 (TBX10) (as WB positive control) 100 ug
$436.00
TP312862 Recombinant protein of human T-box 10 (TBX10), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products