OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RASSF7 (NM_003475) Human Mass Spec Standard

Be the first to review this product
SKU
PH312844
RASSF7 MS Standard C13 and N15-labeled recombinant protein (NP_003466)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335772 Rabbit Polyclonal Anti-RASSF7 Antibody
100 ul
$525.00
LY418659 Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 (RASSF7), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "RASSF7 or NM_003475"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212844
Predicted MW 39.8 kDa
Protein Sequence
Protein Sequence
>RC212844 representing NM_003475
Red=Cloning site Green=Tags(s)

MLLGLAAMELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQLLPQECPVGAQ
ATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPG
PAAPVTPTPGCCTDLRGLELRVQRNAEELGHEAFWEQELRREQAREREGQARLQALSAATAEHAARLQAL
DAQARALEAELQLAAEAPGPPSPMASATERLHQDLAVQERQSAEVQGSLALVSRALEAAERALQAQAQEL
EELNRELRQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHAGAQPRPRGGPHDA
ELLEVAAAPAPEWCPLAAQPQAL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003466
RefSeq Size 1539
RefSeq ORF 1119
Synonyms C11orf13; CFAP88; FAP88; HRAS1; HRC1
Locus ID 8045
UniProt ID Q02833
Cytogenetics 11p15.5
Summary Negatively regulates stress-induced JNK activation and apoptosis by promoting MAP2K7 phosphorylation and inhibiting its ability to activate JNK. Following prolonged stress, anti-apoptotic effect stops because of degradation of RASSF7 protein via the ubiquitin-proteasome pathway. Required for the activation of AURKB and chromosomal congression during mitosis where it stimulates microtubule polymerization.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RASSF7" proteins (5)
SKU Description Size Price
LC418659 Lyophilized RASSF7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428453 Lyophilized RASSF7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418659 Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 (RASSF7), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428453 Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 (RASSF7), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP312844 Recombinant protein of human Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 (RASSF7), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products