GMPPA (NM_205847) Human Mass Spec Standard

SKU
PH312726
GMPPA MS Standard C13 and N15-labeled recombinant protein (NP_995319)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212726]
Predicted MW 46.3 kDa
Protein Sequence
Protein Sequence
>RC212726 protein sequence
Red=Cloning site Green=Tags(s)

MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEPLTQFLE
AAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGSPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLL
GTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEDS
PGLWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQIKSAGSALYASRLYLSRYQDTHPERLAKHTPGG
PWIRGNVYIHPTAKVAPSAVLGPNVSIGKGVTVGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRW
ARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_995319
RefSeq Size 1845
RefSeq ORF 1260
Synonyms AAMR
Locus ID 29926
UniProt ID Q96IJ6
Cytogenetics 2q35
Summary This gene is thought to encode a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides. [provided by RefSeq, Jul 2008]
Protein Pathways Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:GMPPA (NM_205847) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403717 GMPPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415641 GMPPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429378 GMPPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403717 Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 2 100 ug
$665.00
LY415641 Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 1 100 ug
$436.00
LY429378 Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 1 100 ug
$436.00
TP312726 Recombinant protein of human GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.