RASGRP2 (NM_001098670) Human Mass Spec Standard

SKU
PH312672
RASGRP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092140)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212672]
Predicted MW 69.2 kDa
Protein Sequence
Protein Sequence
>RC212672 protein sequence
Red=Cloning site Green=Tags(s)

MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNS
LQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPVG
QKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLM
ILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELV
TATGNYGNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSL
RPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSV
LGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGS
APSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001092140
RefSeq Size 2244
RefSeq ORF 1827
Synonyms CALDAG-GEFI; CDC25L
Locus ID 10235
UniProt ID Q7LDG7
Cytogenetics 11q13.1
Summary The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can activate small GTPases, including RAS and RAP1/RAS3. The nucleotide exchange activity of this protein can be stimulated by calcium and diacylglycerol. Four alternatively spliced transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]
Protein Pathways Chemokine signaling pathway, MAPK signaling pathway
Write Your Own Review
You're reviewing:RASGRP2 (NM_001098670) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312719 RASGRP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092141) 10 ug
$3,255.00
PH317525 RASGRP2 MS Standard C13 and N15-labeled recombinant protein (NP_722541) 10 ug
$3,255.00
LC406966 RASGRP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420662 RASGRP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420663 RASGRP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406966 Transient overexpression lysate of RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 2 100 ug
$665.00
LY420662 Transient overexpression lysate of RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 3 100 ug
$665.00
LY420663 Transient overexpression lysate of RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 4 100 ug
$665.00
TP312672 Recombinant protein of human RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 3, 20 µg 20 ug
$737.00
TP312719 Recombinant protein of human RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 4, 20 µg 20 ug
$737.00
TP317525 Recombinant protein of human RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.