MNX1 (NM_005515) Human Mass Spec Standard

SKU
PH312606
MNX1 MS Standard C13 and N15-labeled recombinant protein (NP_005506)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212606]
Predicted MW 40.57 kDa
Protein Sequence
Protein Sequence
>RC212606 representing NM_005515
Red=Cloning site Green=Tags(s)

MEKSKNFRIDALLAVDPPRAASAQSAPLALVTSLAAAASGTGGGGGGGGASGGTSGSCSPASSEPPAAPA
DRLRAESPSPPRLLAAHCALLPKPGFLGAGGGGGGTGGGHGGPHHHAHPGAAAAAAAAAAAAAAGGLALG
LHPGGAQGGAGLPAQAALYGHPVYGYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGAGTFQL
DQWLRASTAGMILPKMPDFNSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLML
TETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGAGKGGAEEPGAEELLGPPAPGDKGSGRRLRD
LRDSDPEEDEDEDDEDHFPYSNGASVHAASSDCSSEDDSPPPRPSHQPAPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005506
RefSeq Size 2176
RefSeq ORF 1203
Synonyms HB9; HLXB9; HOXHB9; SCRA1
Locus ID 3110
UniProt ID P50219
Cytogenetics 7q36.3
Summary This gene encodes a nuclear protein, which contains a homeobox domain and is a transcription factor. Mutations in this gene result in Currarino syndrome, an autosomic dominant congenital malformation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Protein Pathways Maturity onset diabetes of the young
Write Your Own Review
You're reviewing:MNX1 (NM_005515) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401692 MNX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401692 Transient overexpression lysate of motor neuron and pancreas homeobox 1 (MNX1), transcript variant 1 100 ug
$436.00
TP312606 Recombinant protein of human motor neuron and pancreas homeobox 1 (MNX1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.