SERINC3 (NM_006811) Human Mass Spec Standard

SKU
PH312480
SERINC3 MS Standard C13 and N15-labeled recombinant protein (NP_006802)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212480]
Predicted MW 52.4 kDa
Protein Sequence
Protein Sequence
>RC212480 representing NM_006811
Red=Cloning site Green=Tags(s)

MGAVLGVFSLASWVPCLCSGASCLLCSCCPNSKNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPG
FCEGGFKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAA
LIGIMVGSFYIPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFT
SAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITLYTM
YLTWSAMSNEPDRSCNPNLMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLCLLY
SSIRTSTNSQVDKLTLSGSDSVILGDTTTSGASDEEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIM
MTLTSWYSPDAKFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006802
RefSeq Size 2592
RefSeq ORF 1419
Synonyms AIGP1; DIFF33; SBBI99; TDE; TDE1; TMS-1
Locus ID 10955
UniProt ID Q13530
Cytogenetics 20q13.12
Summary Restriction factor required to restrict infectivity of lentiviruses, such as HIV-1: acts by inhibiting an early step of viral infection. Impairs the penetration of the viral particle into the cytoplasm (PubMed:26416733, PubMed:26416734).[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SERINC3 (NM_006811) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402036 SERINC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404656 SERINC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402036 Transient overexpression lysate of serine incorporator 3 (SERINC3), transcript variant 1 100 ug
$436.00
LY404656 Transient overexpression lysate of serine incorporator 3 (SERINC3), transcript variant 2 100 ug
$436.00
TP312480 Recombinant protein of human serine incorporator 3 (SERINC3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.