DUX3 (NM_012148) Human Mass Spec Standard

SKU
PH312415
DUX3 MS Standard C13 and N15-labeled recombinant protein (NP_036280)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212415]
Predicted MW 21.9 kDa
Protein Sequence
Protein Sequence
>RC212415 representing NM_012148
Red=Cloning site Green=Tags(s)

MPAEVHGSPPASLCPCPSVKFRPGLPAMALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRACFERNLY
PGIATKEQLAQGIDIPEPRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQKGRRKRTAITGSQTALLLRAF
EKDRFPGIPAREELARETGLPESRIQLWFQNRRARHWGQSGRAPTQASIRCNAAPIG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036280
RefSeq Size 594
RefSeq ORF 591
Synonyms double homeobox, 3
Locus ID 26582
Summary The human genome contains hundreds of repeats of the 3.3-kb family in regions associated with heterochromatin. The DUX gene family, including DUX3, resides within these 3.3-kb repeated elements (Beckers et al., 2001 [PubMed 11245978]). See DUX4 (MIM 606009).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:DUX3 (NM_012148) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415935 DUX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415935 Transient overexpression lysate of double homeobox, 3 (DUX3) 100 ug
$436.00
TP312415 Recombinant protein of human double homeobox, 3 (DUX3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.