OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IL20 (NM_018724) Human Mass Spec Standard

Be the first to review this product
SKU
PH312397
IL20 MS Standard C13 and N15-labeled recombinant protein (NP_061194)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA803504 IL20 mouse monoclonal antibody, clone OTI2B8 (formerly 2B8) 100 ul
$447.00
LY412869 Transient overexpression lysate of interleukin 20 (IL20) (as WB positive control) 100 ug
$436.00

Other products for "IL20 or NM_018724"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212397
Predicted MW 20.1 kDa
Protein Sequence
Protein Sequence
>RC212397 protein sequence
Red=Cloning site Green=Tags(s)

MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTES
LQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMK
KYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061194
RefSeq Size 1252
RefSeq ORF 528
Synonyms IL-20; IL10D; ZCYTO10
Locus ID 50604
UniProt ID Q9NYY1
Cytogenetics 1q32.1
Summary The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IL20" proteins (4)
SKU Description Size Price
LC412869 Lyophilized IL20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412869 Transient overexpression lysate of interleukin 20 (IL20) (as WB positive control) 100 ug
$436.00
TP312397 Recombinant protein of human interleukin 20 (IL20), 20 µg 20 ug
$867.00
TP720126 Recombinant protein of human interleukin 20 (IL20) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products