NPTX1 (NM_002522) Human Mass Spec Standard

SKU
PH312316
NPTX1 MS Standard C13 and N15-labeled recombinant protein (NP_002513)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212316]
Predicted MW 47.12 kDa
Protein Sequence
Protein Sequence
>RC212316 representing NM_002522
Red=Cloning site Green=Tags(s)

MPAGRAARTCALLALCLLGAGAQDFGPTRFICTSVPVDADMCAASVAAGGAEELRSSVLQLRETVLQQKE
TILSQKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSL
KTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQ
RISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSATPGVGTPFSYAVPGQAN
ELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQ
GVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGA
TKWTFEACRQIN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002513
RefSeq Size 5441
RefSeq ORF 1296
Synonyms NP1
Locus ID 4884
UniProt ID Q15818
Cytogenetics 17q25.3
Summary NPTX1 is a member of the neuronal pentraxin gene family. Neuronal pentraxin 1 is similar to the rat NP1 gene which encodes a binding protein for the snake venom toxin taipoxin. Human NPTX1 mRNA is exclusively localized to the nervous system. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:NPTX1 (NM_002522) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419274 NPTX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419274 Transient overexpression lysate of neuronal pentraxin I (NPTX1) 100 ug
$665.00
TP312316 Recombinant protein of human neuronal pentraxin I (NPTX1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP701040 Purified recombinant protein of Human neuronal pentraxin I (NPTX1), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.