CRYL1 (NM_015974) Human Mass Spec Standard

SKU
PH312304
CRYL1 MS Standard C13 and N15-labeled recombinant protein (NP_057058)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212304]
Predicted MW 35.2 kDa
Protein Sequence
Protein Sequence
>RC212304 representing NM_015974
Red=Cloning site Green=Tags(s)

MASSAAGCVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEE
QLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQ
CIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLV
EEGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGIKHVLQTFGPIPEFSRATAEKV
NQDMCMKVPDDPEHLAARRQWRDECLMRLAKLKSQVQPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057058
RefSeq Size 1516
RefSeq ORF 957
Synonyms GDH; gul3DH; HEL30; lambda-CRY
Locus ID 51084
UniProt ID Q9Y2S2
Cytogenetics 13q12.11
Summary The uronate cycle functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate in the uronate cycle. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CRYL1 (NM_015974) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414265 CRYL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414265 Transient overexpression lysate of crystallin, lambda 1 (CRYL1) 100 ug
$436.00
TP312304 Recombinant protein of human crystallin, lambda 1 (CRYL1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.