JNK2 (MAPK9) (NM_139070) Human Mass Spec Standard

SKU
PH312273
MAPK9 MS Standard C13 and N15-labeled recombinant protein (NP_620709)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212273]
Predicted MW 48.1 kDa
Protein Sequence
Protein Sequence
>RC212273 representing NM_139070
Red=Cloning site Green=Tags(s)

MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRA
YRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIK
HLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWS
VGCIMAEMVLHKVLFPGRDYIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIF
PSESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIE
EWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620709
RefSeq Size 1942
RefSeq ORF 1272
Synonyms JNK-55; JNK2; JNK2A; JNK2ALPHA; JNK2B; JNK2BETA; p54a; p54aSAPK; PRKM9; SAPK; SAPK1a
Locus ID 5601
UniProt ID P45984
Cytogenetics 5q35.3
Summary The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. This gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Sep 2008]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase
Protein Pathways Adipocytokine signaling pathway, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Fc epsilon RI signaling pathway, Focal adhesion, GnRH signaling pathway, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, Type II diabetes mellitus, Wnt signaling pathway
Write Your Own Review
You're reviewing:JNK2 (MAPK9) (NM_139070) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH307608 MAPK9 MS Standard C13 and N15-labeled recombinant protein (NP_620707) 10 ug
$3,255.00
PH312814 MAPK9 MS Standard C13 and N15-labeled recombinant protein (NP_002743) 10 ug
$3,255.00
LC400972 MAPK9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408411 MAPK9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408412 MAPK9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408413 MAPK9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400972 Transient overexpression lysate of mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a2 100 ug
$436.00
LY408411 Transient overexpression lysate of mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a1 100 ug
$436.00
LY408412 Transient overexpression lysate of mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1 100 ug
$436.00
LY408413 Transient overexpression lysate of mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b2 100 ug
$665.00
TP307608 Recombinant protein of human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312273 Recombinant protein of human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312814 Recombinant protein of human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761541 Purified recombinant protein of Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.