MRAS (NM_012219) Human Mass Spec Standard

SKU
PH312259
MRAS MS Standard C13 and N15-labeled recombinant protein (NP_036351)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212259]
Predicted MW 23.7 kDa
Protein Sequence
Protein Sequence
>RC212259 representing NM_012219
Red=Cloning site Green=Tags(s)

MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAG
QEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQ
GKEMATKHNTPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036351
RefSeq Size 3926
RefSeq ORF 624
Synonyms M-RAs; NS11; R-RAS3; RRAS3
Locus ID 22808
UniProt ID O14807
Cytogenetics 3q22.3
Summary This gene encodes a member of the Ras family of small GTPases. These membrane-associated proteins function as signal transducers in multiple processes including cell growth and differentiation, and dysregulation of Ras signaling has been associated with many types of cancer. The encoded protein may play a role in the tumor necrosis factor-alpha and MAP kinase signaling pathways. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]
Protein Families Druggable Genome
Protein Pathways MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction
Write Your Own Review
You're reviewing:MRAS (NM_012219) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318272 MRAS MS Standard C13 and N15-labeled recombinant protein (NP_001078518) 10 ug
$3,255.00
LC415896 MRAS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421269 MRAS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415896 Transient overexpression lysate of muscle RAS oncogene homolog (MRAS), transcript variant 1 100 ug
$436.00
LY421269 Transient overexpression lysate of muscle RAS oncogene homolog (MRAS), transcript variant 2 100 ug
$436.00
TP312259 Recombinant protein of human muscle RAS oncogene homolog (MRAS), transcript variant 1, 20 µg 20 ug
$737.00
TP318272 Recombinant protein of human muscle RAS oncogene homolog (MRAS), transcript variant 2, 20 µg 20 ug
$737.00
TP760665 Purified recombinant protein of Human muscle RAS oncogene homolog (MRAS), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.