RRAGD (NM_021244) Human Mass Spec Standard

SKU
PH312160
RRAGD MS Standard C13 and N15-labeled recombinant protein (NP_067067)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212160]
Predicted MW 45.4 kDa
Protein Sequence
Protein Sequence
>RC212160 representing NM_021244
Red=Cloning site Green=Tags(s)

MSQVLGKPQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPFSTEVKPRILLMGL
RRSGKSSIQKVVFHKMSPNETLFLESTNKICREDVSNSSFVNFQIWDFPGQIDFFDPTFDYEMIFRGTGA
LIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLE
KIHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDM
QTYELCCDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFLALVCFVREESFERK
GLIDYNFHCFRKAIHEVFEVRMKVVKSRKVQNRLQKKKRATPNGTPRVLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067067
RefSeq Size 1453
RefSeq ORF 1200
Synonyms bA11D8.2.1; RAGD
Locus ID 58528
UniProt ID Q9NQL2
Cytogenetics 6q15
Summary RRAGD is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.[supplied by OMIM, Apr 2004]
Write Your Own Review
You're reviewing:RRAGD (NM_021244) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411996 RRAGD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411996 Transient overexpression lysate of Ras-related GTP binding D (RRAGD) 100 ug
$436.00
TP312160 Recombinant protein of human Ras-related GTP binding D (RRAGD), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.