OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNALI1 (NM_003462) Human Mass Spec Standard

Be the first to review this product
SKU
PH312111
DNALI1 MS Standard C13 and N15-labeled recombinant protein (NP_003453)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370943 DNALI1 rabbit polyclonal antibody
100 ul
$310.00
LY418664 Transient overexpression lysate of dynein, axonemal, light intermediate chain 1 (DNALI1) (as WB positive control) 100 ug
$436.00

Other products for "DNALI1 or NM_003462"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212111
Predicted MW 31.7 kDa
Protein Sequence
Protein Sequence
>RC212111 representing NM_003462
Red=Cloning site Green=Tags(s)

MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPP
KTKLPSTPCVPDPTKQAEEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARET
GICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSD
MERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003453
RefSeq Size 2663
RefSeq ORF 840
Synonyms dJ423B22.5; hp28; P28
Locus ID 7802
UniProt ID O14645
Cytogenetics 1p34.3
Summary This gene is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. provided by RefSeq, Jul 2008
Protein Pathways Huntington's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DNALI1" proteins (3)
SKU Description Size Price
LC418664 Lyophilized DNALI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418664 Transient overexpression lysate of dynein, axonemal, light intermediate chain 1 (DNALI1) (as WB positive control) 100 ug
$436.00
TP312111 Recombinant protein of human dynein, axonemal, light intermediate chain 1 (DNALI1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products