DNALI1 (NM_003462) Human Mass Spec Standard

SKU
PH312111
DNALI1 MS Standard C13 and N15-labeled recombinant protein (NP_003453)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212111]
Predicted MW 31.7 kDa
Protein Sequence
Protein Sequence
>RC212111 representing NM_003462
Red=Cloning site Green=Tags(s)

MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPP
KTKLPSTPCVPDPTKQAEEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARET
GICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSD
MERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003453
RefSeq Size 2663
RefSeq ORF 840
Synonyms dJ423B22.5; hp28; P28
Locus ID 7802
UniProt ID O14645
Cytogenetics 1p34.3
Summary This gene is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. [provided by RefSeq, Jul 2008]
Protein Pathways Huntington's disease
Write Your Own Review
You're reviewing:DNALI1 (NM_003462) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418664 DNALI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418664 Transient overexpression lysate of dynein, axonemal, light intermediate chain 1 (DNALI1) 100 ug
$436.00
TP312111 Recombinant protein of human dynein, axonemal, light intermediate chain 1 (DNALI1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.