WBP5 (TCEAL9) (NM_016303) Human Mass Spec Standard

SKU PH312064

WBP5 MS Standard C13 and N15-labeled recombinant protein (NP_057387)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC212064]
• Predicted MW: 12.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC212064 protein sequence; Red=Cloning site Green=Tags(s); ; MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDM; FREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057387
• RefSeq Size: 1102
• RefSeq ORF: 312
• Synonyms: WBP5; WEX6
• Locus ID: 51186
• UniProt ID: Q9UHQ7
• Cytogenetics: Xq22.2
• Summary: The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008]