CTDSP1 (NM_021198) Human Mass Spec Standard

SKU
PH312037
CTDSP1 MS Standard C13 and N15-labeled recombinant protein (NP_067021)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212037]
Predicted MW 29.2 kDa
Protein Sequence
Protein Sequence
>RC212037 protein sequence
Red=Cloning site Green=Tags(s)

MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAI
PKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQ
RMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPA
SYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067021
RefSeq Size 2655
RefSeq ORF 783
Synonyms NIF3; NLI-IF; NLIIF; SCP1
Locus ID 58190
UniProt ID Q9GZU7
Cytogenetics 2q35
Summary This gene encodes a member of the small C-terminal domain phosphatase (SCP) family of nuclear phosphatases. These proteins play a role in transcriptional regulation through specific dephosphorylation of phosphoserine 5 within tandem heptapeptide repeats of the C-terminal domain of RNA polymerase II. The encoded protein plays a role in neuronal gene silencing in non-neuronal cells, and may also inhibit osteoblast differentiation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]
Protein Families Phosphatase
Write Your Own Review
You're reviewing:CTDSP1 (NM_021198) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303408 CTDSP1 MS Standard C13 and N15-labeled recombinant protein (NP_872580) 10 ug
$3,255.00
LC403640 CTDSP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412037 CTDSP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403640 Transient overexpression lysate of CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 (CTDSP1), transcript variant 2 100 ug
$436.00
LY412037 Transient overexpression lysate of CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 (CTDSP1), transcript variant 1 100 ug
$436.00
TP303408 Recombinant protein of human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 (CTDSP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312037 Recombinant protein of human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 (CTDSP1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.