ZSCAN2 (NM_001007072) Human Mass Spec Standard

SKU PH311929

ZSCAN2 MS Standard C13 and N15-labeled recombinant protein (NP_001007073)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC211929]
• Predicted MW: 16.2 kDa
• Protein Sequence:
  Protein Sequence

  >RC211929 representing NM_001007072; Red=Cloning site Green=Tags(s); ; MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVT; RGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSETASC; VHGCPV; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001007073
• RefSeq Size: 951
• RefSeq ORF: 438
• Synonyms: ZFP29; ZNF854
• Locus ID: 54993
• UniProt ID: Q7Z7L9
• Cytogenetics: 15q25.2
• Summary: The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors