OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZSCAN2 (NM_001007072) Human Mass Spec Standard

Be the first to review this product
SKU
PH311929
ZSCAN2 MS Standard C13 and N15-labeled recombinant protein (NP_001007073)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA332280 Rabbit Polyclonal Anti-ZSCAN2 Antibody
100 ul
$585.00
LY423575 Transient overexpression lysate of zinc finger and SCAN domain containing 2 (ZSCAN2), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "ZSCAN2 or NM_001007072"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211929
Predicted MW 16.2 kDa
Protein Sequence
Protein Sequence
>RC211929 representing NM_001007072
Red=Cloning site Green=Tags(s)

MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVT
RGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSETASC
VHGCPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001007073
RefSeq Size 951
RefSeq ORF 438
Synonyms ZFP29; ZNF854
Locus ID 54993
UniProt ID Q7Z7L9
Cytogenetics 15q25.2
Summary The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZSCAN2" proteins (3)
SKU Description Size Price
LC423575 Lyophilized ZSCAN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423575 Transient overexpression lysate of zinc finger and SCAN domain containing 2 (ZSCAN2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP311929 Recombinant protein of human zinc finger and SCAN domain containing 2 (ZSCAN2), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products