ACSL6 (NM_001009185) Human Mass Spec Standard

SKU
PH311883
ACSL6 MS Standard C13 and N15-labeled recombinant protein (NP_001009185)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211883]
Predicted MW 80.4 kDa
Protein Sequence
Protein Sequence
>RC211883 representing NM_001009185
Red=Cloning site Green=Tags(s)

MLTFFLVSGGSLWLFVEFVLSLLEKMQTQEILRILRLPELGDLGQFFRSLSATTLVSMGALAAILAYWFT
HRPKALQPPCNLLMQSEEVEDSGGARRSVIGSGPQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFRKPK
QPYQWLSYQEVADRAEFLGSGLLQHNCKACTDQFIGVFAQNRPEWIIVELACYTYSMVVVPLYDTLGPGA
IRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFEEALKERGQKCGVVIKSMQAVEDCG
QENHQAPVPPQPDDLSIVCFTSGTTGNPKGAMLTHGNVVADFSGFLKVTEKVIFPRQDDVLISFLPLAHM
FERVIQSVVYCHGGRVGFFQGDIRLLSDDMKALCPTIFPVVPRLLNRMYDKIFSQANTPLKRWLLEFAAK
RKQAEVRSGIIRNDSIWDELFFNKIQASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTA
GCTFTTPGDWTSGHVGAPLPCNHIKLVDVEELNYWACKGEGEICVRGPNVFKGYLKDPDRTKEALDSDGW
LHTGDIGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGIVVPDP
EVMPSWAQKRGIEGTYADLCTNKDLKKAILEDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLK
AKRPELREYFKKQIEELYSISM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001009185
RefSeq Size 3047
RefSeq ORF 2166
Synonyms ACS2; FACL6; LACS2; LACS5; LACS 6
Locus ID 23305
UniProt ID Q9UKU0
Cytogenetics 5q31.1
Summary The protein encoded by this gene catalyzes the formation of acyl-CoA from fatty acids, ATP, and CoA, using magnesium as a cofactor. The encoded protein plays a major role in fatty acid metabolism in the brain. Translocations with the ETV6 gene are causes of myelodysplastic syndrome with basophilia, acute myelogenous leukemia with eosinophilia, and acute eosinophilic leukemia. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Apr 2011]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway
Write Your Own Review
You're reviewing:ACSL6 (NM_001009185) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316974 ACSL6 MS Standard C13 and N15-labeled recombinant protein (NP_056071) 10 ug
$3,255.00
LC414683 ACSL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422907 ACSL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414683 Transient overexpression lysate of acyl-CoA synthetase long-chain family member 6 (ACSL6), transcript variant 1 100 ug
$665.00
LY422907 Transient overexpression lysate of acyl-CoA synthetase long-chain family member 6 (ACSL6), transcript variant 2 100 ug
$665.00
TP311883 Recombinant protein of human acyl-CoA synthetase long-chain family member 6 (ACSL6), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316974 Recombinant protein of human acyl-CoA synthetase long-chain family member 6 (ACSL6), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.