CTAG2 (NM_172377) Human Mass Spec Standard
CAT#: PH311659
CTAG2 MS Standard C13 and N15-labeled recombinant protein (NP_758965)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211659 |
Predicted MW | 18.3 kDa |
Protein Sequence |
>RC211659 protein sequence
Red=Cloning site Green=Tags(s) MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAAS AQDGRCPCGARRPDSRLLELHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFIRLTAA DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQAPSGQRR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 µg/µL as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_758965 |
RefSeq Size | 773 |
RefSeq ORF | 540 |
Synonyms | CAMEL; CT2; CT6.2; CT6.2a; CT6.2b; ESO2; LAGE-1; LAGE2B |
Locus ID | 30848 |
UniProt ID | O75638 |
Cytogenetics | Xq28 |
Summary | This gene encodes an autoimmunogenic tumor antigen that belongs to the ESO/LAGE family of cancer-testis antigens. This protein is expressed in a wide array of cancers including melanoma, breast cancer, bladder cancer and prostate cancer. This protein is also expressed in normal testis tissue. An alternative open reading frame product of this gene has been described in PMID:10399963. This alternate protein, termed CAMEL, is a tumor antigen that is recognized by melanoma-specific cytotoxic T-lymphocytes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406703 | CTAG2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406703 | Transient overexpression lysate of cancer/testis antigen 2 (CTAG2), transcript variant 1 |
USD 436.00 |
|
TP311659 | Recombinant protein of human cancer/testis antigen 2 (CTAG2), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review