CLEC10A (NM_006344) Human Mass Spec Standard

SKU
PH311598
CLEC10A MS Standard C13 and N15-labeled recombinant protein (NP_006335)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211598]
Predicted MW 32.7 kDa
Protein Sequence
Protein Sequence
>RC211598 representing NM_006344
Red=Cloning site Green=Tags(s)

MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLV
TLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQV
ATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGS
AYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVC
EAGLGQTSQESH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006335
RefSeq Size 1716
RefSeq ORF 876
Synonyms CD301; CLECSF13; CLECSF14; HML; HML2; MGL
Locus ID 10462
UniProt ID Q8IUN9
Cytogenetics 17p13.1
Summary This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CLEC10A (NM_006344) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405320 CLEC10A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416712 CLEC10A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405320 Transient overexpression lysate of C-type lectin domain family 10, member A (CLEC10A), transcript variant 1 100 ug
$436.00
LY416712 Transient overexpression lysate of C-type lectin domain family 10, member A (CLEC10A), transcript variant 2 100 ug
$436.00
TP311598 Recombinant protein of human C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720473 Recombinant protein of human C-type lectin domain family 10, member A (CLEC10A), transcript variant 2 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.