RSK4 (RPS6KA6) (NM_014496) Human Mass Spec Standard

SKU
PH311545
RPS6KA6 MS Standard C13 and N15-labeled recombinant protein (NP_055311)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211545]
Predicted MW 83.7 kDa
Protein Sequence
Protein Sequence
>RC211545 representing NM_014496
Red=Cloning site Green=Tags(s)

MLPFAPQDEPWDREMEVFSGGGASSGEVNGLKMVDEPMEEGEADSCHDEGVVKEIPITHHVKEGYEKADP
AQFELLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLKKASLKVRDRVRTKMERDILVEVNHPFIVKLHY
AFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLAELALALDHLHQLGIVYRDLKPENILLDEIG
HIKLTDFGLSKESVDQEKKAYSFCGTVEYMAPEVVNRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRNE
TMNMILKAKLGMPQFLSAEAQSLLRMLFKRNPANRLGSEGVEEIKRHLFFANIDWDKLYKREVQPPFKPA
SGKPDDTFCFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAA
QFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSKRDPSEEIEILMRYGQHPNIITLKDVFDDG
RYVYLVTDLMKGGELLDRILKQKCFSEREASDILYVISKTVDYLHCQGVVHRDLKPSNILYMDESASADS
IRICDFGFAKQLRGENGLLLTPCYTANFVAPEVLMQQGYDAACDIWSLGVLFYTMLAGYTPFANGPNDTP
EEILLRIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVS
HVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055311
RefSeq Size 2640
RefSeq ORF 2235
Synonyms p90RSK6; PP90RSK4; RSK-4; RSK4; S6K-alpha-6
Locus ID 27330
UniProt ID Q9UK32
Cytogenetics Xq21.1
Summary This gene encodes a member of ribosomal S6 kinase family, serine-threonine protein kinases which are regulated by growth factors. The encoded protein may be distinct from other members of this family, however, as studies suggest it is not growth factor dependent and may not participate in the same signaling pathways. [provided by RefSeq, Jan 2010]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Long-term potentiation, MAPK signaling pathway, mTOR signaling pathway, Neurotrophin signaling pathway, Oocyte meiosis, Progesterone-mediated oocyte maturation
Write Your Own Review
You're reviewing:RSK4 (RPS6KA6) (NM_014496) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402340 RPS6KA6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402340 Transient overexpression lysate of ribosomal protein S6 kinase, 90kDa, polypeptide 6 (RPS6KA6) 100 ug
$665.00
TP311545 Recombinant protein of human ribosomal protein S6 kinase, 90kDa, polypeptide 6 (RPS6KA6), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.