COP1 (RFWD2) (NM_001001740) Human Mass Spec Standard

SKU
PH311483
RFWD2 MS Standard C13 and N15-labeled recombinant protein (NP_001001740)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211483]
Predicted MW 77.5 kDa
Protein Sequence
Protein Sequence
>RC211483 representing NM_001001740
Red=Cloning site Green=Tags(s)

MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLV
APAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNGLINSYEDKSNDFVCPICF
DMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHS
NGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREEMSGLYS
PVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFST
RMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKK
IKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEK
RCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYD
LRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDY
IACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGT
IKVLELV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001001740
RefSeq Size 2729
RefSeq ORF 2121
Synonyms CFAP78; FAP78; RFWD2; RNF200
Locus ID 64326
UniProt ID Q8NHY2
Cytogenetics 1q25.1-q25.2
Summary E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in JUN ubiquitination and degradation. Directly involved in p53 (TP53) ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1. Involved in 14-3-3 protein sigma/SFN ubiquitination and proteasomal degradation, leading to AKT activation and promotion of cell survival. Ubiquitinates MTA1 leading to its proteasomal degradation. Upon binding to TRIB1, ubiquitinates CEBPA, which lacks a canonical COP1-binding motif (Probable).[UniProtKB/Swiss-Prot Function]
Protein Pathways p53 signaling pathway, Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:COP1 (RFWD2) (NM_001001740) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310492 RFWD2 MS Standard C13 and N15-labeled recombinant protein (NP_071902) 10 ug
$3,255.00
LC411672 RFWD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424225 RFWD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411672 Transient overexpression lysate of ring finger and WD repeat domain 2 (RFWD2), transcript variant 1 100 ug
$436.00
LY424225 Transient overexpression lysate of ring finger and WD repeat domain 2 (RFWD2), transcript variant 2 100 ug
$665.00
TP310492 Recombinant protein of human ring finger and WD repeat domain 2 (RFWD2), transcript variant 1, 20 µg 20 ug
$737.00
TP311483 Recombinant protein of human ring finger and WD repeat domain 2 (RFWD2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.