RFC4 (NM_181573) Human Mass Spec Standard

SKU
PH311392
RFC4 MS Standard C13 and N15-labeled recombinant protein (NP_853551)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211392]
Predicted MW 39.5 kDa
Protein Sequence
Protein Sequence
>RC211392 representing NM_181573
Red=Cloning site Green=Tags(s)

MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGAD
LPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKP
CPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQR
LLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAA
CQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLIS
LCATVMQQLSQNC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_853551
RefSeq Size 1395
RefSeq ORF 1089
Synonyms A1; RFC37
Locus ID 5984
UniProt ID P35249
Cytogenetics 3q27.3
Summary The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways DNA replication, Mismatch repair, Nucleotide excision repair
Write Your Own Review
You're reviewing:RFC4 (NM_181573) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300426 RFC4 MS Standard C13 and N15-labeled recombinant protein (NP_002907) 10 ug
$3,255.00
LC405706 RFC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419019 RFC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405706 Transient overexpression lysate of replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 2 100 ug
$436.00
LY419019 Transient overexpression lysate of replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 1 100 ug
$436.00
TP300426 Recombinant protein of human replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP311392 Recombinant protein of human replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.