DDR2 (NM_006182) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC211389] |
Predicted MW | 96.74 kDa |
Protein Sequence |
Protein Sequence
>RC211389 representing NM_006182
Red=Cloning site Green=Tags(s) MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDG AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQV LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII YLNDSVYDGAVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRN FTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQY HFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPDYQEPSRLIRK LPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPR KLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMS RLKDPNIIHLLAVCITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKY LSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDV WAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP SFQEIHLLLLQQGDE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006173 |
RefSeq Size | 3172 |
RefSeq ORF | 2565 |
Synonyms | MIG20a; NTRKR3; TKT; TYRO10; WRCN |
Locus ID | 4921 |
UniProt ID | Q16832 |
Cytogenetics | 1q23.3 |
Summary | This gene encodes a member of the discoidin domain receptor subclass of the receptor tyrosine kinase (RTKs) protein family. RTKs play a key role in the communication of cells with their microenvironment. The encoded protein is a collagen-induced receptor that activates signal transduction pathways involved in cell adhesion, proliferation, and extracellular matrix remodeling. This protein is expressed in numerous cell types and may alos be involved in wound repair and regulate tumor growth and invasiveness. Mutations in this gene are the cause of short limb-hand type spondylometaepiphyseal dysplasia. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH308745 | DDR2 MS Standard C13 and N15-labeled recombinant protein (NP_001014796) | 10 ug |
$3,255.00
|
|
LC416820 | DDR2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423080 | DDR2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC425366 | DDR2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY416820 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 2 | 100 ug |
$436.00
|
|
LY423080 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1 | 100 ug |
$436.00
|
|
LY425366 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1 | 100 ug |
$665.00
|
|
TP308745 | Recombinant protein of human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP311389 | Recombinant protein of human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP700162 | Purified recombinant protein of human discoidin domain receptor tyrosine kinase 2(DDR2), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg | 20 ug |
$867.00
|
|
TP710142 | Recombinant protein of human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1, residues 22-399aa, with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.