DDR2 (NM_006182) Human Mass Spec Standard

SKU
PH311389
DDR2 MS Standard C13 and N15-labeled recombinant protein (NP_006173)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211389]
Predicted MW 96.74 kDa
Protein Sequence
Protein Sequence
>RC211389 representing NM_006182
Red=Cloning site Green=Tags(s)

MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDG
AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQV
LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII
YLNDSVYDGAVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRN
FTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQY
HFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPDYQEPSRLIRK
LPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPR
KLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMS
RLKDPNIIHLLAVCITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKY
LSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDV
WAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP
SFQEIHLLLLQQGDE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006173
RefSeq Size 3172
RefSeq ORF 2565
Synonyms MIG20a; NTRKR3; TKT; TYRO10; WRCN
Locus ID 4921
UniProt ID Q16832
Cytogenetics 1q23.3
Summary This gene encodes a member of the discoidin domain receptor subclass of the receptor tyrosine kinase (RTKs) protein family. RTKs play a key role in the communication of cells with their microenvironment. The encoded protein is a collagen-induced receptor that activates signal transduction pathways involved in cell adhesion, proliferation, and extracellular matrix remodeling. This protein is expressed in numerous cell types and may alos be involved in wound repair and regulate tumor growth and invasiveness. Mutations in this gene are the cause of short limb-hand type spondylometaepiphyseal dysplasia. [provided by RefSeq, Aug 2017]
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Write Your Own Review
You're reviewing:DDR2 (NM_006182) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH308745 DDR2 MS Standard C13 and N15-labeled recombinant protein (NP_001014796) 10 ug
$3,255.00
LC416820 DDR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423080 DDR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425366 DDR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416820 Transient overexpression lysate of discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 2 100 ug
$436.00
LY423080 Transient overexpression lysate of discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1 100 ug
$436.00
LY425366 Transient overexpression lysate of discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1 100 ug
$665.00
TP308745 Recombinant protein of human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1, 20 µg 20 ug
$737.00
TP311389 Recombinant protein of human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 2, 20 µg 20 ug
$737.00
TP700162 Purified recombinant protein of human discoidin domain receptor tyrosine kinase 2(DDR2), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$867.00
TP710142 Recombinant protein of human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1, residues 22-399aa, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.