KCTD16 (NM_020768) Human Mass Spec Standard

SKU
PH311283
KCTD16 MS Standard C13 and N15-labeled recombinant protein (NP_065819)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211283]
Predicted MW 49.1 kDa
Protein Sequence
Protein Sequence
>RC211283 protein sequence
Red=Cloning site Green=Tags(s)

MALSGNCSRYYPREQGSAVPNSFPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSPKRDTANDLAKDSK
GRFFIDRDGFLFRYILDYLRDRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFE
DASQGSDTRICPPSSLLPADRKWGFITVGYRGSCTLGREGQADAKFRRVPRILVCGRISLAKEVFGETLN
ESRDPDRAPERYTSRFYLKFKHLERAFDMLSECGFHMVACNSSVTASFINQYTDDKIWSSYTEYVFYREP
SRWSPSHCDCCCKNGKGDKEGESGTSCNDLSTSSCDSQSEASSPQETVICGPVTRQTNIQTLDRPIKKGP
VQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLSIEEELEKCIQDFLKIKIPDRFPERKHPWQS
ELLRKYHL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065819
RefSeq Size 5183
RefSeq ORF 1284
Locus ID 57528
UniProt ID Q68DU8
Cytogenetics 5q31.3
Summary Auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. Increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:KCTD16 (NM_020768) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412323 KCTD16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412323 Transient overexpression lysate of potassium channel tetramerisation domain containing 16 (KCTD16) 100 ug
$436.00
TP311283 Recombinant protein of human potassium channel tetramerisation domain containing 16 (KCTD16), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.