OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CAMK2N2 (NM_033259) Human Mass Spec Standard

Be the first to review this product
SKU
PH311256
CAMK2N2 MS Standard C13 and N15-labeled recombinant protein (NP_150284)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY409633 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II inhibitor 2 (CAMK2N2) (as WB positive control) 100 ug
$436.00

Other products for "CAMK2N2 or NM_033259"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211256
Predicted MW 8.7 kDa
Protein Sequence
Protein Sequence
>RC211256 protein sequence
Red=Cloning site Green=Tags(s)

MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKG
MGEKPPSGV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_150284
RefSeq Size 1360
RefSeq ORF 237
Synonyms CAM-KIIN; CAMKIIN
Locus ID 94032
UniProt ID Q96S95
Cytogenetics 3q27.1
Summary This gene encodes a protein that is highly similar to the rat CaM-KII inhibitory protein, an inhibitor of calcium/calmodulin-dependent protein kinase II (CAMKII). CAMKII regulates numerous physiological functions, including neuronal synaptic plasticity through the phosphorylation of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid-type glutamate (AMPA) receptors. Studies of the similar protein in rat suggest that this protein may function as a negative regulator of CaM-KII and may act to inhibit the phosphorylation of AMPA receptors. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CAMK2N2" proteins (3)
SKU Description Size Price
LC409633 Lyophilized CAMK2N2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409633 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II inhibitor 2 (CAMK2N2) (as WB positive control) 100 ug
$436.00
TP311256 Recombinant protein of human calcium/calmodulin-dependent protein kinase II inhibitor 2 (CAMK2N2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products