CAMK2N2 (NM_033259) Human Mass Spec Standard

SKU
PH311256
CAMK2N2 MS Standard C13 and N15-labeled recombinant protein (NP_150284)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211256]
Predicted MW 8.7 kDa
Protein Sequence
Protein Sequence
>RC211256 protein sequence
Red=Cloning site Green=Tags(s)

MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKG
MGEKPPSGV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_150284
RefSeq Size 1360
RefSeq ORF 237
Synonyms CAM-KIIN; CAMKIIN
Locus ID 94032
UniProt ID Q96S95
Cytogenetics 3q27.1
Summary This gene encodes a protein that is highly similar to the rat CaM-KII inhibitory protein, an inhibitor of calcium/calmodulin-dependent protein kinase II (CAMKII). CAMKII regulates numerous physiological functions, including neuronal synaptic plasticity through the phosphorylation of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid-type glutamate (AMPA) receptors. Studies of the similar protein in rat suggest that this protein may function as a negative regulator of CaM-KII and may act to inhibit the phosphorylation of AMPA receptors. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CAMK2N2 (NM_033259) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409633 CAMK2N2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409633 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II inhibitor 2 (CAMK2N2) 100 ug
$436.00
TP311256 Recombinant protein of human calcium/calmodulin-dependent protein kinase II inhibitor 2 (CAMK2N2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.