Tyrosine Hydroxylase (TH) (NM_000360) Human Mass Spec Standard

SKU
PH311218
TH MS Standard C13 and N15-labeled recombinant protein (NP_000351)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211218]
Predicted MW 55.7 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC211218
Blue=ORF Red=Cloning site Green=Tag(s)

MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIEDARKEREAAVAAVAAAVPSEPGDPLE
AVAFEEKEGKAMLNLLFSPRATKPSALSRAVKVFETFEAKIHHLETRPAQRPRAGGPHLEYFVRLEVRR
GDLAALLSGVRQVSEDVRSPAGPKVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIA
EIAFQYRHGDPIPRVEYTAEEIATWKEVYTTLKGLYATHACGEHLEAFALLERFSGYREDNIPQLEDVS
RFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADRTFA
QFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDP
EAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQ
DELDTLAHALSAIG

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV

Recombinant protein using RC211218 also available, TP311218M
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000351
RefSeq Size 1817
RefSeq ORF 1491
Synonyms DYT5b; DYT14; TYH
Locus ID 7054
UniProt ID P07101
Cytogenetics 11p15.5
Summary The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Parkinson's disease, Tyrosine metabolism
Write Your Own Review
You're reviewing:Tyrosine Hydroxylase (TH) (NM_000360) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424777 TH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424777 Transient overexpression lysate of tyrosine hydroxylase (TH), transcript variant 2 100 ug
$436.00
TP311218 Recombinant protein of human tyrosine hydroxylase (TH), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.