TUBA8 (NM_018943) Human Mass Spec Standard

SKU
PH311175
TUBA8 MS Standard C13 and N15-labeled recombinant protein (NP_061816)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211175]
Predicted MW 50.1 kDa
Protein Sequence
Protein Sequence
>RC211175 protein sequence
Red=Cloning site Green=Tags(s)

MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGNGKHVPRAVMIDL
EPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLDRIRKLTDACSGLQGFLIFHS
FGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY
DICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEK
AYHEQLSVAEITSSCFEPNSQMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTG
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGTDSFEEENEGEEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061816
RefSeq Size 2124
RefSeq ORF 1347
Synonyms CDCBM8; TUBAL2
Locus ID 51807
UniProt ID Q9NY65
Cytogenetics 22q11.21
Summary This gene encodes a member of the alpha tubulin protein family. Alpha tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene are associated with polymicrogyria and optic nerve hypoplasia. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2010]
Protein Families Druggable Genome
Protein Pathways Gap junction, Pathogenic Escherichia coli infection
Write Your Own Review
You're reviewing:TUBA8 (NM_018943) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412867 TUBA8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412867 Transient overexpression lysate of tubulin, alpha 8 (TUBA8) 100 ug
$436.00
TP311175 Recombinant protein of human tubulin, alpha 8 (TUBA8), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.