ARA9 (AIP) (NM_003977) Human Mass Spec Standard

SKU
PH311157
AIP MS Standard C13 and N15-labeled recombinant protein (NP_003968)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211157]
Predicted MW 37.7 kDa
Protein Sequence
Protein Sequence
>RC211157 protein sequence
Red=Cloning site Green=Tags(s)

MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKL
PVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDA
LQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLK
NLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWN
AQEAQADFAKVLELDPALAPVVSRELRALEARIRQKDEEDKARFRGIFSH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003968
RefSeq Size 1250
RefSeq ORF 990
Synonyms ARA9; FKBP16; FKBP37; PITA1; SMTPHN; XAP-2; XAP2
Locus ID 9049
UniProt ID O00170
Cytogenetics 11q13.2
Summary The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:ARA9 (AIP) (NM_003977) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401308 AIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401308 Transient overexpression lysate of aryl hydrocarbon receptor interacting protein (AIP) 100 ug
$436.00
TP311157 Recombinant protein of human aryl hydrocarbon receptor interacting protein (AIP), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.