Cyclin A2 (CCNA2) (NM_001237) Human Mass Spec Standard

SKU
PH311148
CCNA2 MS Standard C13 and N15-labeled recombinant protein (NP_001228)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211148]
Predicted MW 48.4 kDa
Protein Sequence
Protein Sequence
>RC211148 representing NM_001237
Red=Cloning site Green=Tags(s)

MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTR
RVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKP
LVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSM
RAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVY
ITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKY
LPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
VSLLNPPETLNL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001228
RefSeq Size 1682
RefSeq ORF 1296
Synonyms CCN1; CCNA
Locus ID 890
UniProt ID P20248
Cytogenetics 4q27
Summary The protein encoded by this gene belongs to the highly conserved cyclin family, whose members function as regulators of the cell cycle. This protein binds and activates cyclin-dependent kinase 2 and thus promotes transition through G1/S and G2/M. [provided by RefSeq, Aug 2016]
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Cell cycle, Progesterone-mediated oocyte maturation
Write Your Own Review
You're reviewing:Cyclin A2 (CCNA2) (NM_001237) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400494 CCNA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400494 Transient overexpression lysate of cyclin A2 (CCNA2) 100 ug
$436.00
TP311148 Recombinant protein of human cyclin A2 (CCNA2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.