HMG2L1 (HMGXB4) (NM_005487) Human Mass Spec Standard

SKU
PH311137
HMGXB4 MS Standard C13 and N15-labeled recombinant protein (NP_005478)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211137]
Predicted MW 53.2 kDa
Protein Sequence
Protein Sequence
>RC211137 protein sequence
Red=Cloning site Green=Tags(s)

MDLLKAITSPLAAGSKPSKKTGEKSSGSSSHSESKKEHHRKKVSGSSGELPLEDGVSHKSKKMKPLYVNT
ETLTLREPDGLKMKLILSPKEKGSSSVDEESFQYPSQQATVKKSSKKSARDEQGALLLGHELQSFLKTAR
KKHKSSSDAHSSPGPEGCGSDASQFAESHSANLDLSGLEPILVESDSSSGGELEAGELVIDDSYREIKKK
KKSKKSKKKKDKEKHKEKRHSKSKRSLGLSAVPVGEVTVTSGPPPSIPYAGAAAPPLPLPGLHTDGHSEK
KKKKEEKDKERERGEKPKKKNMSAYQVFCKEYRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQK
AQYLQHKQNKAEATTVKRKASSSEGSMKVKASSVGVLSPQKKSPPTTMLLPASPAKAPETEPIDVAAHLQ
LLGESLSLIGHRLQETEGMVAVSGSLSVLLDSIICALGPLACLTTQLPELNGCPKQVLSNTLDNIAYIMP
GL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005478
RefSeq Size 4220
RefSeq ORF 1476
Synonyms high-mobility group protein 2-like 1; HMG2L1; HMGBCG; HMG box domain containing 4; OTTHUMP00000028778; THC211630
Locus ID 10042
UniProt ID Q9UGU5
Cytogenetics 22q12.3
Summary High mobility group (HMG) proteins are nonhistone chromosomal proteins. See HMG2 (MIM 163906) for additional information on HMG proteins.[supplied by OMIM, Nov 2010]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:HMG2L1 (HMGXB4) (NM_005487) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415406 HMGXB4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417272 HMGXB4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415406 Transient overexpression lysate of HMG box domain containing 4 (HMGXB4), transcript variant 2 100 ug
$665.00
LY417272 Transient overexpression lysate of HMG box domain containing 4 (HMGXB4), transcript variant 1 100 ug
$436.00
TP311137 Recombinant protein of human HMG box domain containing 4 (HMGXB4), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.