gamma Tubulin (TUBG2) (NM_016437) Human Mass Spec Standard

SKU
PH311127
TUBG2 MS Standard C13 and N15-labeled recombinant protein (NP_057521)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211127]
Predicted MW 51.1 kDa
Protein Sequence
Protein Sequence
>RC211127 protein sequence
Red=Cloning site Green=Tags(s)

MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLE
PRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHS
IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTAL
NRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ
SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIP
WGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDE
MDRSREVVQELIDEYHAATQPDYISWGTQEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057521
RefSeq Size 1841
RefSeq ORF 1353
Locus ID 27175
UniProt ID Q9NRH3
Cytogenetics 17q21.2
Summary Tubulin is the major constituent of microtubules. The gamma chain is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome. Pericentriolar matrix component that regulates alpha/beta chain minus-end nucleation, centrosome duplication and spindle formation (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:gamma Tubulin (TUBG2) (NM_016437) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414021 TUBG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414021 Transient overexpression lysate of tubulin, gamma 2 (TUBG2) 100 ug
$436.00
TP311127 Recombinant protein of human tubulin, gamma 2 (TUBG2), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.