PCPTP1 (PTPRR) (NM_130846) Human Mass Spec Standard

SKU
PH311122
PTPRR MS Standard C13 and N15-labeled recombinant protein (NP_570897)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211122]
Predicted MW 46.6 kDa
Protein Sequence
Protein Sequence
>RC211122 protein sequence
Red=Cloning site Green=Tags(s)

MILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIRA
TTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMEYLQSASRILTRSQLRD
VVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGY
SGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNEC
DNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRT
GCFIATSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_570897
RefSeq Size 2782
RefSeq ORF 1236
Synonyms EC-PTP; PCPTP1; PTP-SL; PTPBR7; PTPRQ
Locus ID 5801
UniProt ID Q15256
Cytogenetics 12q15
Summary The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domain, and thus represents a receptor-type PTP. Silencing of this gene has been associated with colorectal cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares a symbol (PTPRQ) with another gene, protein tyrosine phosphatase, receptor type, Q (GeneID 374462), which is also located on chromosome 12. [provided by RefSeq, May 2011]
Protein Families Druggable Genome, Phosphatase, Transmembrane
Protein Pathways MAPK signaling pathway
Write Your Own Review
You're reviewing:PCPTP1 (PTPRR) (NM_130846) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312896 PTPRR MS Standard C13 and N15-labeled recombinant protein (NP_002840) 10 ug
$3,255.00
LC408898 PTPRR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419077 PTPRR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408898 Transient overexpression lysate of protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 2 100 ug
$436.00
LY419077 Transient overexpression lysate of protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 1 100 ug
$665.00
TP311122 Recombinant protein of human protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312896 Recombinant protein of human protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.