NECAP1 (NM_015509) Human Mass Spec Standard

SKU
PH311100
NECAP1 MS Standard C13 and N15-labeled recombinant protein (NP_056324)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211100]
Predicted MW 29.7 kDa
Protein Sequence
Protein Sequence
>RC211100 protein sequence
Red=Cloning site Green=Tags(s)

MATELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKLEDKVSGELFA
QAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQESEISKES
QEMDARPKLDLGFKEGQTIKLCIGNITNKKGGASKPRTARGGGLSLLPPPPGGKVTIPPPSSSVAISNHV
TPPPIPKSNHGGSDADILLDLDSPAPVTTPAPTPVSVSNDLWGDFSTASSSVPNQAPQPSNWVQF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056324
RefSeq Size 2600
RefSeq ORF 825
Synonyms DEE21; EIEE21
Locus ID 25977
UniProt ID Q8NC96
Cytogenetics 12p13.31
Summary This gene encodes a protein containing two characteristic WXXF motifs. The encoded protein localizes to clathrin-coated vesicles, where it binds components of the adapter protein complexes and aids in endocytosis. Loss of function of this gene results in early infantile epileptic encephalopathy-21. There is a pseudogene for this gene on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]
Write Your Own Review
You're reviewing:NECAP1 (NM_015509) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414502 NECAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414502 Transient overexpression lysate of NECAP endocytosis associated 1 (NECAP1), transcript variant 1 100 ug
$436.00
TP311100 Recombinant protein of human NECAP endocytosis associated 1 (NECAP1), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.