SUMF1 (NM_182760) Human Mass Spec Standard

SKU
PH311092
SUMF1 MS Standard C13 and N15-labeled recombinant protein (NP_877437)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211092]
Predicted MW 40.6 kDa
Protein Sequence
Protein Sequence
>RC211092 protein sequence
Red=Cloning site Green=Tags(s)

MAAPALGLVCGRCPELGLVLLLLLLSLLCGAAGSQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRY
SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFV
NSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVS
WNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAP
VDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARS
QNTPDSSASNLGFRCAADRLPTMD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_877437
RefSeq Size 2179
RefSeq ORF 1122
Synonyms AAPA3037; FGE; UNQ3037
Locus ID 285362
UniProt ID Q8NBK3
Cytogenetics 3p26.1
Summary This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]
Write Your Own Review
You're reviewing:SUMF1 (NM_182760) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405331 SUMF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431307 SUMF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431311 SUMF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405331 Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 1 100 ug
$436.00
LY431307 Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 2 100 ug
$436.00
LY431311 Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 3 100 ug
$436.00
TP311092 Recombinant protein of human sulfatase modifying factor 1 (SUMF1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720417 Recombinant protein of human sulfatase modifying factor 1 (SUMF1) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.