VMA21 (NM_001017980) Human Mass Spec Standard

SKU
PH311043
VMA21 MS Standard C13 and N15-labeled recombinant protein (NP_001017980)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211043]
Predicted MW 11.4 kDa
Protein Sequence
Protein Sequence
>RC211043 protein sequence
Red=Cloning site Green=Tags(s)

MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAI
VAVVAVHVVLALFVYVAWNEGSRQWREGKQD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001017980
RefSeq Size 4760
RefSeq ORF 303
Synonyms MEAX; XMEA
Locus ID 203547
UniProt ID Q3ZAQ7
Cytogenetics Xq28
Summary This gene encodes a chaperone for assembly of lysosomal vacuolar ATPase.[provided by RefSeq, Jul 2012]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:VMA21 (NM_001017980) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC422224 VMA21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY422224 Transient overexpression lysate of VMA21 vacuolar H+-ATPase homolog (S. cerevisiae) (VMA21) 100 ug
$436.00
TP311043 Recombinant protein of human VMA21 vacuolar H+-ATPase homolog (S. cerevisiae) (VMA21), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.