CYP7A1 (NM_000780) Human Mass Spec Standard

SKU
PH311019
CYP7A1 MS Standard C13 and N15-labeled recombinant protein (NP_000771)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211019]
Predicted MW 57.7 kDa
Protein Sequence
Protein Sequence
>RC211019 protein sequence
Red=Cloning site Green=Tags(s)

MMTTSLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQRKHGHVFTCK
LMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGNTTENINDTFIKTLQGHALNS
LTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMFEAGYLTIFGRDLTRRDTQKAHILNNLDNFK
QFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHL
VVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSII
KESLRLSSASLNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTK
TTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQSRAGLGILP
PLNDIEFKYKFKHL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000771
RefSeq Size 2875
RefSeq ORF 1512
Synonyms CP7A; CYP7; CYPVII
Locus ID 1581
UniProt ID P22680
Cytogenetics 8q12.1
Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway in the liver, which converts cholesterol to bile acids. This reaction is the rate limiting step and the major site of regulation of bile acid synthesis, which is the primary mechanism for the removal of cholesterol from the body. Polymorphisms in the promoter of this gene are associated with defects in bile acid synthesis. [provided by RefSeq, Feb 2010]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, P450, Transmembrane
Protein Pathways Metabolic pathways, PPAR signaling pathway, Primary bile acid biosynthesis
Write Your Own Review
You're reviewing:CYP7A1 (NM_000780) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424522 CYP7A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424522 Transient overexpression lysate of cytochrome P450, family 7, subfamily A, polypeptide 1 (CYP7A1) 100 ug
$436.00
TP311019 Recombinant protein of human cytochrome P450, family 7, subfamily A, polypeptide 1 (CYP7A1), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.