Otoraplin (OTOR) (NM_020157) Human Mass Spec Standard

SKU PH310984

OTOR MS Standard C13 and N15-labeled recombinant protein (NP_064542)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210984]
• Predicted MW: 14.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC210984 protein sequence; Red=Cloning site Green=Tags(s); ; MARILLLFLPGLVAVCAVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYS; KLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_064542
• RefSeq Size: 1482
• RefSeq ORF: 384
• Synonyms: FDP; MIAL1
• Locus ID: 56914
• UniProt ID: Q9NRC9
• Cytogenetics: 20p12.1
• Summary: This gene encodes a member of the melanoma-inhibiting activity gene family. The encoded protein is secreted via the Golgi apparatus and may function in cartilage development and maintenance. A frequent polymorphism in the translation start codon of this gene can abolish translation and may be associated with forms of deafness. [provided by RefSeq, Jul 2013]
• Protein Families: Secreted Protein, Transmembrane