OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

POU2F3 (NM_014352) Human Mass Spec Standard

Be the first to review this product
SKU
PH310969
POU2F3 MS Standard C13 and N15-labeled recombinant protein (NP_055167)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA330590 Rabbit Polyclonal Anti-POU2F3 Antibody
100 ul
$585.00
LY415336 Transient overexpression lysate of POU class 2 homeobox 3 (POU2F3) (as WB positive control) 100 ug
$436.00

Other products for "POU2F3 or NM_014352"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210969
Predicted MW 47.4 kDa
Protein Sequence
Protein Sequence
>RC210969 protein sequence
Red=Cloning site Green=Tags(s)

MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPA
MMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQGLQPNLLPFPQQQSGLLLPQ
TGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSGGADEPSDLEELEKFAKTFKQRRIKLGFTQG
DVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGR
KRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPIKPP
VYNSRLVSPSGSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSF
NSSGSWYRWNHSTYLH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055167
RefSeq Size 3013
RefSeq ORF 1308
Synonyms Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Locus ID 25833
UniProt ID Q9UKI9
Cytogenetics 11q23.3
Summary This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Sep 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "POU2F3" proteins (3)
SKU Description Size Price
LC415336 Lyophilized POU2F3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415336 Transient overexpression lysate of POU class 2 homeobox 3 (POU2F3) (as WB positive control) 100 ug
$436.00
TP310969 Recombinant protein of human POU class 2 homeobox 3 (POU2F3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products