INSL5 (NM_005478) Human Mass Spec Standard

SKU
PH310968
INSL5 MS Standard C13 and N15-labeled recombinant protein (NP_005469)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210968]
Predicted MW 15.3 kDa
Protein Sequence
Protein Sequence
>RC210968 protein sequence
Red=Cloning site Green=Tags(s)

MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHK
REFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005469
RefSeq Size 718
RefSeq ORF 405
Synonyms PRO182; UNQ156
Locus ID 10022
UniProt ID Q9Y5Q6
Cytogenetics 1p31.3
Summary The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7). [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:INSL5 (NM_005478) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417280 INSL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417280 Transient overexpression lysate of insulin-like 5 (INSL5) 100 ug
$436.00
TP310968 Recombinant protein of human insulin-like 5 (INSL5), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.