nkx6.2 (NKX6-2) (NM_177400) Human Mass Spec Standard

SKU
PH310963
NKX6 MS Standard C13 and N15-labeled recombinant protein (NP_796374)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210963]
Predicted MW 29.1 kDa
Protein Sequence
Protein Sequence
>RC210963 representing NM_177400
Red=Cloning site Green=Tags(s)

MDTNRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDILGRPVGA
AGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPGVVQGAPWRDPRLAGPAPAGG
VLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAE
MASAKKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNSDDEKITRLLKKHKPSNLALVSPCGGGAGDAL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_796374
RefSeq Size 834
RefSeq ORF 831
Synonyms GTX; NKX6.2; NKX6B; SPAX8
Locus ID 84504
UniProt ID Q9C056
Cytogenetics 10q26.3
Summary Transcription factor with repressor activity involved in the regulation of axon-glial interactions at myelin paranodes in oligodendrocytes. Binds to the consensus DNA sequence 5'-(A/T)TTAATGA-3'. In oligodendrocytes, binds to MBP and PLP1 promoter regions.[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:nkx6.2 (NKX6-2) (NM_177400) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406150 NKX6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406150 Transient overexpression lysate of NK6 homeobox 2 (NKX6-2) 100 ug
$436.00
TP310963 Recombinant protein of human NK6 homeobox 2 (NKX6-2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.