TSGA2 (RSPH1) (NM_080860) Human Mass Spec Standard

SKU
PH310926
RSPH1 MS Standard C13 and N15-labeled recombinant protein (NP_543136)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210926]
Predicted MW 35.1 kDa
Protein Sequence
Protein Sequence
>RC210926 protein sequence
Red=Cloning site Green=Tags(s)

MSDLGSEELEEEGENDIGEYEGGRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGE
YVRNKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGT
WVNGQQEGTAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWK
ATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESRE
YDQEEFRYDMDEGNINSEEEETRQSDLQD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_543136
RefSeq Size 1445
RefSeq ORF 927
Synonyms CT79; RSP44; RSPH10A; TSA2; TSGA2
Locus ID 89765
UniProt ID Q8WYR4
Cytogenetics 21q22.3
Summary This gene encodes a male meiotic metaphase chromosome-associated acidic protein. This gene is expressed in tissues with motile cilia or flagella, including the trachea, lungs, airway brushings, and testes. Mutations in this gene result in primary ciliary dyskinesia-24. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]
Write Your Own Review
You're reviewing:TSGA2 (RSPH1) (NM_080860) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409012 RSPH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409012 Transient overexpression lysate of radial spoke head 1 homolog (Chlamydomonas) (RSPH1) 100 ug
$436.00
TP310926 Recombinant protein of human radial spoke head 1 homolog (Chlamydomonas) (RSPH1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.