GNG13 (NM_016541) Human Mass Spec Standard

SKU
PH310828
GNG13 MS Standard C13 and N15-labeled recombinant protein (NP_057625)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210828]
Predicted MW 7.9 kDa
Protein Sequence
Protein Sequence
>RC210828 protein sequence
Red=Cloning site Green=Tags(s)

MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057625
RefSeq Size 1001
RefSeq ORF 201
Synonyms G(gamma)13; h2-35
Locus ID 51764
UniProt ID Q9P2W3
Cytogenetics 16p13.3
Summary Heterotrimeric G proteins, which consist of alpha (see MIM 139320), beta (see MIM 139380), and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction (Li et al., 2006 [PubMed 16473877]).[supplied by OMIM, Oct 2009]
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway, Taste transduction
Write Your Own Review
You're reviewing:GNG13 (NM_016541) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413914 GNG13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413914 Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 13 (GNG13) 100 ug
$436.00
TP310828 Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 13 (GNG13), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.