Retinoic Acid Receptor gamma (RARG) (NM_000966) Human Mass Spec Standard

SKU
PH310815
RARG MS Standard C13 and N15-labeled recombinant protein (NP_000957)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210815]
Predicted MW 50.3 kDa
Protein Sequence
Protein Sequence
>RC210815 protein sequence
Red=Cloning site Green=Tags(s)

MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSS
EEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRN
RCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKY
TTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYT
PEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKV
DKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000957
RefSeq Size 2992
RefSeq ORF 1362
Synonyms NR1B3; RARC
Locus ID 5916
UniProt ID P13631
Cytogenetics 12q13.13
Summary This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimers to the retinoic acid response elements (RARE) found in the promoter regions of the target genes. In their unbound form, RARs repress transcription of their target genes. RARs are involved in various biological processes, including limb bud development, skeletal growth, and matrix homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Write Your Own Review
You're reviewing:Retinoic Acid Receptor gamma (RARG) (NM_000966) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400354 RARG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420799 RARG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400354 Transient overexpression lysate of retinoic acid receptor, gamma (RARG), transcript variant 1 100 ug
$436.00
LY420799 Transient overexpression lysate of retinoic acid receptor, gamma (RARG), transcript variant 2 100 ug
$665.00
TP310815 Recombinant protein of human retinoic acid receptor, gamma (RARG), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.