VPS26C (NM_006052) Human Mass Spec Standard

SKU
PH310755
DSCR3 MS Standard C13 and N15-labeled recombinant protein (NP_006043)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210755]
Predicted MW 33 kDa
Protein Sequence
Protein Sequence
>RC210755 protein sequence
Red=Cloning site Green=Tags(s)

MGTALDIKIKRANKVYHAGEVLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQ
IINSTIEMVKPGKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFI
VHSAPQKGKFTPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQPLTGELVVESSEAAIRSVE
LQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLSVPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLL
HPDHLITENFPLKLCRI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006043
RefSeq Size 3252
RefSeq ORF 891
Synonyms DCRA; DSCR3; DSCRA
Locus ID 10311
UniProt ID O14972
Cytogenetics 21q22.13
Summary The region of chromosome 21 between genes CBR and ERG (CBR-ERG region), which spans 2.5 Mb on 21q22.2, has been defined by analysis of patients with partial trisomy 21. It contributes significantly to the pathogenesis of many characteristics of Down syndrome, including morphological features, hypotonia, and cognitive disability. The DSCR3 (Down syndrome critical region gene 3) gene is found in this region and is predictated to contain eight exons. DSCR3 is expressed in most tissues examined. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:VPS26C (NM_006052) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416904 DSCR3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416904 Transient overexpression lysate of Down syndrome critical region gene 3 (DSCR3) 100 ug
$436.00
TP310755 Recombinant protein of human Down syndrome critical region gene 3 (DSCR3), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.