WW domain binding protein 4 (WBP4) (NM_007187) Human Mass Spec Standard

SKU
PH310721
WBP4 MS Standard C13 and N15-labeled recombinant protein (NP_009118)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210721]
Predicted MW 42.5 kDa
Protein Sequence
Protein Sequence
>RC210721 protein sequence
Red=Cloning site Green=Tags(s)

MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEA
AALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYY
YDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDDFIPHTSDLPSSKVN
ENSLGTLDESKSSDSHSDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGS
NEEKSKTLKKSNPYGEWQEIKQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMAD
GVAPVFKKRRTENGKSRNLRQRGDDQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009118
RefSeq Size 2354
RefSeq ORF 1128
Synonyms FBP21
Locus ID 11193
UniProt ID O75554
Cytogenetics 13q14.11
Summary This gene encodes WW domain-containing binding protein 4. The WW domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron bridging of U1 and U2 snRNPs in the spliceosomal complex A. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:WW domain binding protein 4 (WBP4) (NM_007187) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416138 WBP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416138 Transient overexpression lysate of WW domain binding protein 4 (formin binding protein 21) (WBP4) 100 ug
$436.00
TP310721 Recombinant protein of human WW domain binding protein 4 (formin binding protein 21) (WBP4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.